PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 352012
Common NameARALYDRAFT_352012
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family MYB_related
Protein Properties Length: 200aa    MW: 22652.3 Da    PI: 7.1952
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
352012genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding42.91.1e-1394138347
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      +W++ E+ l++++ +++G+g+Wk I+r+  k Rt  q+ s+ qky
           352012  94 PWSQNEHRLFLEGLNKFGKGDWKNISRHCVKSRTSTQVASHAQKY 138
                      7*******************************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM007175.6354IPR001005SANT/Myb domain
SuperFamilySSF466892.43E-6659IPR009057Homeodomain-like
PROSITE profilePS5129415.4387143IPR017930Myb domain
SuperFamilySSF466892.09E-1788144IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.8E-1089144IPR009057Homeodomain-like
TIGRFAMsTIGR015576.2E-1690141IPR006447Myb domain, plants
SMARTSM007171.8E-891141IPR001005SANT/Myb domain
PfamPF002493.4E-1094138IPR001005SANT/Myb domain
CDDcd001671.60E-994139No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 200 aa     Download sequence    Send to blast
MAAAPQWTRA DDKDFESALV IFPEGSPYFL ENIAQTLKKT VDEVNNHYNT LVHDVDLIES  60
GKFVLPKYPD DDYVTLTEAS PSRNKGTGKK NGIPWSQNEH RLFLEGLNKF GKGDWKNISR  120
HCVKSRTSTQ VASHAQKYFN RLKRGITDGK RSSIHDMTLG DVENVPGSNL TCMDQQPHFG  180
DQISWNQCYL SQENFPVFR*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002872443.11e-151hypothetical protein ARALYDRAFT_352012
SwissprotQ8S9H74e-38DIV_ANTMA; Transcription factor DIVARICATA
TrEMBLD7LX921e-151D7LX92_ARALL; Putative uncharacterized protein
STRINGfgenesh1_pg.C_scaffold_60026051e-150(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM14731719
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G09450.13e-99MYB_related family protein